PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0634s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 326aa    MW: 37937.4 Da    PI: 6.7905
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0634s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.44e-5571361129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhP+deelv++yL+kk+++k+++l +vik+vd+y++ePwdL++  k+ + +++ewyfFs++dkky+tg+r+nratk+g+Wk
  SapurV1A.0634s0120.1.p   7 VPPGFRFHPSDEELVDYYLRKKIASKRIDL-DVIKDVDLYRIEPWDLQElcKLGTeDQNEWYFFSHKDKKYPTGTRTNRATKAGFWK 92 
                             69****************************.9***************954544442556**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk++++ +++l+g++ktLvfykgrap+g+k dW+mheyrle
  SapurV1A.0634s0120.1.p  93 ATGRDKAIYT-RHSLIGMRKTLVFYKGRAPNGQKLDWIMHEYRLE 136
                             **********.889*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-615156IPR003441NAC domain
PROSITE profilePS5100559.5137156IPR003441NAC domain
PfamPF023654.8E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPSDEEL VDYYLRKKIA SKRIDLDVIK DVDLYRIEPW DLQELCKLGT  60
EDQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YTRHSLIGMR KTLVFYKGRA  120
PNGQKLDWIM HEYRLETNEN GTPEEEGWVV CRVFKKRVPT MRKVGDYDSP SWYDEQVSFM  180
PETGSPRRIS QPYASYHHHY PCKHELELQY NMPHDPFLQL PQLESPEVPQ MQQCHQQNLN  240
SLYRNNNCEQ AVDQVTDWRV LDKFVASQLA SHEDASKGTS NFSNTATFNA AEQMNVLANE  300
SKGSEIAQEY ASTSTSSCLI DQLWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-49615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999340.0AB599934.1 Populus trichocarpa PtVNS03 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368170.10.0no apical meristem family protein
SwissprotQ9FWX21e-152NAC7_ARATH; NAC domain-containing protein 7
TrEMBLF1T1080.0F1T108_POPTR; Transcription factor
STRINGPOPTR_0001s00220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-143NAC 007